PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013598760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 374aa    MW: 42940.6 Da    PI: 8.456
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013598760.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix81.41.2e-25279360185
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                     rW+++ev+aLi+ r+++ee+ +    + + W++vs+km+erg+ers+k+Ckekwen+nk+yk++ eg+k  ++e+s+t +yf++l
  XP_013598760.1 279 RWPHEEVQALIDSRSQVEEKTGFH--RVAIWDDVSAKMKERGYERSAKKCKEKWENMNKYYKRVVEGKKT-QPEHSKTRSYFEKL 360
                     8*******************9998..899****************************************8.59**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.96E-5278362IPR009057Homeodomain-like
CDDcd122038.12E-22278340No hitNo description
Gene3DG3DSA:1.10.10.608.7E-4278334IPR009057Homeodomain-like
PfamPF138371.1E-18278360No hitNo description
PROSITE profilePS500907.097279334IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MELLAGNCRK RPADDFAEDV DPFGSSEWMY GSRSLRTQGN DDALATLADL APPPQKLKPI  60
RCVVKPPSED RQHPLDILAG SLDRLPPEMG FLGDGGCFEA PLGSKIADVE ESGQLTRGFS  120
KDEVEMEVRG RVSRRDGVSL SSSADSDSDS SQGGRKAKRK RKTREKMEHF VEKLVGSMMK  180
RQEKMHNQLI KVMEKMEHER IRSEEAWRQQ DIERMKQNVE ARMREMSRSS SIISFIKSVI  240
GEEEDIEMPN LTIPLPKQCE SAHQRQGDDV KFVFPSGRRW PHEEVQALID SRSQVEEKTG  300
FHRVAIWDDV SAKMKERGYE RSAKKCKEKW ENMNKYYKRV VEGKKTQPEH SKTRSYFEKL  360
GKLYKTNSVV DKEE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2367850.0AC236785.1 Brassica napus clone JBnB015G17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013598760.10.0PREDICTED: trihelix transcription factor GT-2-like
TrEMBLA0A0D3D9X30.0A0A0D3D9X3_BRAOL; Uncharacterized protein
STRINGBra024925.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94112736
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47660.11e-130Trihelix family protein